>AT3G03710.1 |  RIF10 (resistant to inhibition with FSM 10) 3-5-exoribonuclease/ RNA binding / nucleic acid binding / polyribonucleotide nucleotidyltransferase 
MLTSPSNALHSSTPQFWPLRRSKLCRSRNFPRFHSGERSSGGGGKLCSLSLLSGSGAGKF 
SVRALVRPDDTDDADSVGDGSLAFPNHVSVKIPFGNREILVETGLMGRQASSAVTVTDGE 
TIVYTSVCLADVPSEPSDFLPLYVHYQERFSAVGRTSGGFFKREGRTKDHEVLICRLIDR 
PLRPTMPKGFYNETQILSWVLSYDGLHAPDALAVTSAGIAVALSEVPNAKAIAGVRVGLI 
GGEFIVNPTVKEMEESQLDLFLAGTDTAILTIEGYSNFLPEEMLLQAVKVGQDAVQATCI 
AIEVLAKKYGKPKMLDAIRLPPPELYKHVKELAGEELTKALQIKSKISRRKAISSLEEKV 
LTILTEKGYVIDEVAFGTIEAQPDLLEDEDEDEEVVPEGEVDQGDVHIRPIPRKPIPLLF 
SEVDVKLVFKEVSSKLLRRRIVEGGKRSDGRTLDEIRPINSRCGLLPRAHGSTLFTRGET 
QALAVVTLGDKQMAQRIDNLEGSDEYKRFYLQYTFPPSSVGEVGRIGAPSRREIGHGTLA 
ERALETILPSDDDFPYTIRVESTVIESNGSSSMASVCGGCLALQDAGVPVKCSVAGIAMG 
MVWDTEEFGGDGSPLILSDITGAEDASGDMDFKVAGNEDGVTAFQMDIKVGGITLEIMEK 
ALIQAKAGRRHILAEMAKCSPPPTLSLSKYAPLILIMKVHPSKVYSLIGSGGKKVKSIIE 
ESGVEAIDMQDDGTVKIMAIDVASLERAKAIISGLTMVPSVGDIYRNCEIKSMAPYGAFV 
EIAPGREGLCHISELSAEWLAKPEDAYKVGDRIDVKLIEVNEKGQLRLSVRALLPESETD 
KDSQKQQPAGDSTKDKSSQRKYVNTSSKDRAAAGASKVSSGDELVLKKKDVRRATGGSSD 
KTMNSNSSTNEESLVNGEATIS*
>AT2G33800.1 |  ribosomal protein S5 family protein 
MATASALSSLSSLSLHTRTSSLISSSSTKSIVSFSSFLNRRFSSLTLVKASSTDTETIFF 
EDETPEITANVVFDPPIAPEGFVSPPYFDEGSDETEEEIATAFEELYGPAYSGESMLGKD 
IYVMDSKHKKSSGIGGKPKKDKIRDGFEERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQG 
NVGVGCAKAKEVVAAVQKSAIDARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPASPGT 
GVIAGGAVRIVLEMAGVENALGKQLGSNNALNNARATLAAVQQMRQFRDVAQERGIPMEE 
LWK*
>AT3G63490.1 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAA 
VKSVETNKPKGAKGVYWKSAHICSSMGPSIKLNIREMIDFKPPTAN*
>AT3G63490.1 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAA 
VKSVETNKPKGAKGVYWKSAHICSSMGPSIKLNIREMIDFKPPTAN*
>AT3G63490.2 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQSSRRGKLNSEQTKLGLFTFHLGKLILQRKTFS*
>AT3G63490.2 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQSSRRGKLNSEQTKLGLFTFHLGKLILQRKTFS*
>AT1G56190.1 |  phosphoglycerate kinase putative 
MASTAATAALSIIKSTGGAAVTRSSRASFGHIPSTSVSARRLGFSAVVDSRFSVHVASKV 
HSVRGKGARGVITMAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPT 
IKFLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVA 
SLPEGGVLLLENVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLK 
PSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIF 
TFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPA 
SAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK 
KGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPVTV*
>AT1G56190.1 |  phosphoglycerate kinase putative 
MASTAATAALSIIKSTGGAAVTRSSRASFGHIPSTSVSARRLGFSAVVDSRFSVHVASKV 
HSVRGKGARGVITMAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPT 
IKFLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVA 
SLPEGGVLLLENVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLK 
PSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIF 
TFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPA 
SAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK 
KGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPVTV*
>AT1G56190.2 |  phosphoglycerate kinase putative 
MAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVIL 
STHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENV 
RFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELD 
YLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSS 
LVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIG 
PDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSKKGVTTIIGGGDSV 
AAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPVTV*
>AT1G56190.2 |  phosphoglycerate kinase putative 
MAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVIL 
STHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENV 
RFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELD 
YLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSS 
LVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIG 
PDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSKKGVTTIIGGGDSV 
AAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPVTV*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT3G44890.1 |  RPL9 (RIBOSOMAL PROTEIN L9) structural constituent of ribosome 
MASSTALSLSWSSSPCWSHSFNGGANETLKVSERRFNFEVVSQKKAKKLRKVILKEDVTD 
LGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELKMEDERIEAEKQRVKEEAQQLAMV 
FQTVGAFKVKRKGGKGKLIFGSVTAQDLVDIIKSQLQKDIDKRLVSLPEIRETGEYIAEL 
KLHPDVTARVKINVFAN*
>AT4G01310.1 |  ribosomal protein L5 family protein 
MASPSLLQSSASSFHGRFSPLAAPSSARMLSPPLRNVVKVSASGTVLVEKSEAEKTQRLK 
TAYLERIIPALKEEFKYVNIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKP 
IKTRARASIATFKIREDQPLGIAVTLRGDVMYSFLDRLINLALPRTRDFQGVSPSSFDGN 
GNYSIGVKDQGVFPEIRFDAVGKTRGMDVCISTTAKSDQEGQKLLALMGMPFREGGGGST 
GAIVRKKKLKSHHFDAKGKGKR*
>AT1G79050.1 |  DNA repair protein recA 
MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAKKLSHKI 
SSEFDDRINGALSPDADSRFLDRQKALEAAMNDINSSFGKGSVTRLGSAGGALVETFSSG 
ILTLDLALGGGLPKGRVVEIYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYS 
KALGVDVENLIVCQPDNGEMALETADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQM 
GLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLE 
IRSAGKIKSSKGDEDIGLRARVRVQKSKVSRPYKQAEFEIMFGEGVSKLGCVLDCAEIME 
VVVKKGSWYSYEDQRLGQGREKALQHLRENPALQDEIEKKVRLLMLDGEVHRSTPLMSSS 
SSSASHREEEEEDSLDDFQ*
>AT1G79050.1 |  DNA repair protein recA 
MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAKKLSHKI 
SSEFDDRINGALSPDADSRFLDRQKALEAAMNDINSSFGKGSVTRLGSAGGALVETFSSG 
ILTLDLALGGGLPKGRVVEIYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYS 
KALGVDVENLIVCQPDNGEMALETADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQM 
GLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLE 
IRSAGKIKSSKGDEDIGLRARVRVQKSKVSRPYKQAEFEIMFGEGVSKLGCVLDCAEIME 
VVVKKGSWYSYEDQRLGQGREKALQHLRENPALQDEIEKKVRLLMLDGEVHRSTPLMSSS 
SSSASHREEEEEDSLDDFQ*
>AT1G79050.2 |  DNA repair protein recA 
MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAKKLSHKI 
SSEFDDRINGALSPDADSRFLDRQKALEAAMNDINSSFGKGSVTRLGSAGGALVETFSSG 
ILTLDLALGGGLPKGRVVEIYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYS 
KALGVDVENLIVCQPDNGEMALETADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQM 
GLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLE 
IRSAGKIKSSKGDEDIGLRARVRVQKSKVSRPYKQEERKHCST*
>AT1G79050.2 |  DNA repair protein recA 
MDSQLVLSLKLNPSFTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAKKLSHKI 
SSEFDDRINGALSPDADSRFLDRQKALEAAMNDINSSFGKGSVTRLGSAGGALVETFSSG 
ILTLDLALGGGLPKGRVVEIYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYS 
KALGVDVENLIVCQPDNGEMALETADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQM 
GLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLE 
IRSAGKIKSSKGDEDIGLRARVRVQKSKVSRPYKQEERKHCST*
>AT5G14320.1 |  30S ribosomal protein S13 chloroplast (CS13) 
MAQMVAMPVAHSLSLICNWAKSNPLSRNTLALPASNTPNKQSLSIRCARVGGVEIPANKR 
IEYSLQYIHGIGRTRARQILVDLQMENKITKDMAEEELIILRDEVSKYMIEGDLRRFNAL 
AIKRLKEIQCYRGVRHIQGLPCRGQRTKNNCRTLKGKKIAIAGKKKVSK*
>AT5G14320.1 |  30S ribosomal protein S13 chloroplast (CS13) 
MAQMVAMPVAHSLSLICNWAKSNPLSRNTLALPASNTPNKQSLSIRCARVGGVEIPANKR 
IEYSLQYIHGIGRTRARQILVDLQMENKITKDMAEEELIILRDEVSKYMIEGDLRRFNAL 
AIKRLKEIQCYRGVRHIQGLPCRGQRTKNNCRTLKGKKIAIAGKKKVSK*
>AT5G14320.2 |  30S ribosomal protein S13 chloroplast (CS13) 
MAQMVAMPVAHSLSLICNWAKSNPLSRNTLALPASNTPNKQSLSIRCARVGGVEIPANKR 
IEYSLQYIHGIGRTRARQILVDLQMENKITKDMAEEELIILRDEVSKYMIEGDLVIHFPL 
HLHTLGHE*
>AT5G14320.2 |  30S ribosomal protein S13 chloroplast (CS13) 
MAQMVAMPVAHSLSLICNWAKSNPLSRNTLALPASNTPNKQSLSIRCARVGGVEIPANKR 
IEYSLQYIHGIGRTRARQILVDLQMENKITKDMAEEELIILRDEVSKYMIEGDLVIHFPL 
HLHTLGHE*
>AT1G05190.1 |  emb2394 (embryo defective 2394) structural constituent of ribosome 
MASSLVSSFQPRSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIA 
LEGQDLKVKGPLGELALTYPREVELTKEESGFLRVKKTVETRRANQMHGLFRTLTDNMVV 
GVSKGFEKKLILVGVGYRATVDGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYD 
KSEIGQFAATVRKWRPPEPYKGKGVKYSDEIVRRKEGKAGKKK*
>AT1G78630.1 |  emb1473 (embryo defective 1473) structural constituent of ribosome 
MAVLCSSSTVILSSSSVKSSGSERKSPFLGFSLTAISKPSVRVGIYANSKRGLQVKCEAE 
PTTTTSLVPANQRWMFDEEEANGPDIWNTTWYPKASDHVNTDKPWFVVDATDKILGRLAS 
TIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRNQKLYRRHSGRPGGMTVETFD 
QLQQRIPERIVEHAVRGMLPKGRLGRALFNHLKVYKGPDHPHEAQKPLDLPIRDKRIQLQ 
K*
>ATCG00380.1 |  Chloroplast encoded ribosomal protein S4 
MSRYRGPRFKKIRRLGALPGLTSKRPKAGSDLRNQSRSVKKSQYRIRLEEKQKLRFHYGL 
TEHQLLKYVRIAGKAKGSTGQVLLQLLEMRLDNILFRLGMALTIPQARQLVNHGHILVNG 
RIVDIPSYRCKPRDIITVKDEQNSRTLVQNLLDSSAPEELPNHLTLHTFQYEGLVNQIID 
RKCVGLKINELLVVEYYSRQT*
>ATCG00740.1 |  RNA polymerase alpha subunit 
MVREKVKVSTRTLQWKCVESKRDSKRLYYGRFILSPLMKGQADTIGIAMRRALLGEIEGT 
CITRAKSENIPHDYSNIAGIQESVHEILMNLNEIVLRSNLYGTRNALICVQGPGYITARD 
IILPPAVEIIDNTQHIATLTEPIDLCIELKIERNRGYSLKMSNNFEDRSYPIDAVFMPVE 
NANHSIHSYGNGNEKQEILFLEIWTNGSLTPKEALHQASRNLINLFIPFLHVEEETFYLE 
NNQHQVTLPFFPFHNRLVNLRKKKKTKELAFQYIFIDQLELPPRIYNCLKKSNIHTLLDL 
LNNSQEDLIKIEHFHVEDVKKILDILEKK*
>ATCG00800.1 |  encodes a chloroplast ribosomal protein S3 a constituent of the small subunit of the ribosomal complex 
MGQKINPLGFRLGTTQSHHSLWFAQPKKYSEGLEEDKKIRDCIKNYVQKNIRISSGMEGI 
ARIEIQKRIDLIQIIIYMGFPKLLIEDKPRRVEELQMNVQKELNCVNRKLNIAITRISNP 
YGDPNILAEFIAGQLKNRVSFRKAMKKAIELTEQANTKGIQVQIAGRIDGKEIARVEWIR 
EGRVPLQTIEAKIDYCSYTVRTIYGVLGIKIWIFVDEE*
>ATCG00810.1 |  encodes a chloroplast ribosomal protein L22 a constituent of the large subunit of the ribosomal complex 
MIKKRKKKSYTEVYALGQYISMSAHKARRVIDQIRGRSYEEALMILELMPYRGCYPIFKL 
VYSAAANASHNKGFKETNLVISKAEVNQGNTVKKLKPRARGRSYPIKRSTCHITIVLEDI 
SFYQQYEEYLMYLKKPGCSNENRNLTCYDTYSSGGLWDKK*
>ATCG00820.1 |  Encodes a 68-kDa protein of the small ribosomal subunit 
VTRSLKKNPFVAKHLLRKIEKLNTKAEKEIIITWSRASTIIPTMIGHTIAIHNGREHLPV 
YIIDLMVGHKLGEFSPTINFRGHAKNDNRSRR*
>ATCG00830.1 |  encodes a chloroplast ribosomal protein L2 a constituent of the large subunit of the ribosomal complex 
MAIHLYKTSTPSTRNGAVDSQVKSNPRNNLICGQHHCGKGRNARGIITARHRGGGHKRLY 
RKIDFRRNAKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEV 
PIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVR 
LISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIG 
RKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK*
>ATCG01240.1 |  30S chloroplast ribosomal protein S7 
MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLS 
VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 
SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR*
>AT2G36530.1 |  LOS2 copper ion binding / phosphopyruvate hydratase 
MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG 
KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 
LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA 
ASFKEAMKMGVEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIEKAG 
YTGKVVIGMDVAASEFYSEDKTYDLNFKEENNNGSQKISGDALKDLYKSFVAEYPIVSIE 
DPFDQDDWEHYAKMTTECGTEVQIVGDDLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVT 
ESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQLL 
RIEEELGSEAIYAGVNFRKPVEPY*
>AT2G36880.1 |  MAT3 (methionine adenosyltransferase 3) copper ion binding / methionine adenosyltransferase 
METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTA 
AKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIGA 
GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDG 
GAMIPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPAKYLDDNTIFHLNPSGRFVI 
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAAGLAR 
RCIVQVSYAIGVPEPLSVFVDTYKTGTIPDKDILVLIKEAFDFRPGMMAINLDLKRGGNF 
RFQKTAAYGHFGRDDPDFTWEVVKPLKPKA*
>AT2G36880.1 |  MAT3 (methionine adenosyltransferase 3) methionine adenosyltransferase 
METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTA 
AKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIGA 
GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDG 
GAMIPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPAKYLDDNTIFHLNPSGRFVI 
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAAGLAR 
RCIVQVSYAIGVPEPLSVFVDTYKTGTIPDKDILVLIKEAFDFRPGMMAINLDLKRGGNF 
RFQKTAAYGHFGRDDPDFTWEVVKPLKPKA*
>AT2G36880.2 |  MAT3 (methionine adenosyltransferase 3) copper ion binding / methionine adenosyltransferase 
METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTA 
AKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIGA 
GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDG 
GAMIPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPAKYLDDNTIFHLNPSGRFVI 
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAAGLAR 
RCIVQVSYAIGVPEPLSVFVDTYKTGTIPDKDILVLIKEAFDFRPGMMAINLDLKRGGNF 
RFQKTAAYGHFGRDDPDFTWEVVKPLKPKA*
>AT2G36880.2 |  MAT3 (methionine adenosyltransferase 3) methionine adenosyltransferase 
METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTA 
AKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIGA 
GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDG 
GAMIPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPAKYLDDNTIFHLNPSGRFVI 
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVAAGLAR 
RCIVQVSYAIGVPEPLSVFVDTYKTGTIPDKDILVLIKEAFDFRPGMMAINLDLKRGGNF 
RFQKTAAYGHFGRDDPDFTWEVVKPLKPKA*
>AT4G38680.1 |  GRP2 (GLYCINE RICH PROTEIN 2) double-stranded DNA binding / mRNA binding / nucleic acid binding / single-stranded DNA binding 
MSGDNGGGERRKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIRSEGFRSLAAEEAVEFE 
VEIDNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGG 
RGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG 
GGGSCYSCGESGHFARDCTSGGR*
>AT4G30930.1 |  NFD1 (NUCLEAR FUSION DEFECTIVE 1) RNA binding / structural constituent of ribosome 
MASLRCFRELSRRATTVFSINQTRSISSFHGIEFSGTSISHGTVIPNRSLTRNLPWYSHW 
YRSQDRCFSSNTKDTDEDEESSEGEDDDEEEGEDFEDSADMEVEREYSPAEKVEEAEEIG 
YKVMGPLKPSERLFKPYEPVFAIVQIGSHQFKVSNGDSIFTEKLKFCDINDKLELTKVLL 
LGSASQTIIGRPILPDATVHAVVEEHALDEKVLIFKKKRRKNYRRTRGHRQELTKLRITD 
IQGIEKPEPKIVHKPSKEAVTEQTKAELVA*
>AT1G80620.1 |  ribosomal protein S15 family protein 
MALHLARPKQRLHSNPSLIHLFSTSSSSSSSSPQDGNESNEQPSQSSSDYKISSYFSGIR 
SSLKQTQSQDGKRQFVRFDAKPQNSLSGNQDIRRNLNEFRSRATAPPPRDMQDLFKQNVL 
SKSGGTRRIEGVPLTNIKANLRQMRPQQATTESKWANLSGIQNIMKTNINDNIRSNVIGG 
AAEGLPHSVVGKELEEEDVTEEEMKSEFIKSYDPIELGEKLRLYRPEGKKEEGWFSLQEL 
NQRLVKLRAMEEEQFQKTSIVHPSFVNNLRSEFHKFTKAQKSDPFQNTNIWGVLSGTPKY 
MLEPPKDQLVETYFHPDNMSSAEKMKIELAKVREEFKMSESDCGSARVQVAQLTTKIKHL 
SSVLHKKDKHSRKGLIAMVQRRKKLLKYMRRTDWDSYCLSLSKLGLRDNPDYKF*
>AT2G20060.1 |  ribosomal protein L4 family protein 
MAASISRRIFRTFGSFSALGRSSSPNLSANTSGNGLASLTNDLKYGMALLSNRKLSTSIL 
TPDDSFPSDLLTKKTVLTPDRTIGQYQDLVIPVTNFQNEEKGFMVLAGDVFDVPIRKDII 
HNVVRWQLAKRQQGTHSTKTLSEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPK 
PRSHAIKMNKQVRRLGLKIALTARAAEGKLLVFDDLGLPTHKTKNIVNYYNQMENTKKVL 
VVEGGPIDEKLKLATQNLHYVNIIPSIGLNVYSILLHDTLLMSRDAVNKIVERMHTPINR 
*
>AT1G63680.1 |  MURE ATP binding / acid-amino acid ligase/ ligase 
MAFTFLSPHPVFLSLTGTTSSFSYKPVLLPFSRNSRTLTVAAGPARRNSYPNPADDDPPE 
APEDSMHGVSKFQQIQRQAARARKLEEEDFEKNRNTYLSAIADVEDAAETGRDDEESGGD 
LFSDIDRAISMKRSEFVKQGLLKPNPPKTASLKKIGEEGNEEEGDVTDDVDELDEEEVVD 
LDEIDKLTGLTEISDEEDWVDEEGNTRINKKKEFGSDHQFEFDLDDFGESKARIVEPKFK 
MCLAELLDESKVVPISVYGDLDVEITGIQHDSRGVSAGDLFVCCLGSENFLSEADKRGAV 
AVVASKEIDIEDTLGCRALVIVEDTNAVLAALASSFYRHPSKNMSVIGVTGTDGKTTTTY 
LIKSLYEAMGVRTGMFSTVSCYIHGDNKLDTPNATMNPDAVLVQSLMAKMLHNGTESLVM 
EASPQELALGKCDEVDFDIAVFTNLTRENTDFRGTDEEYRDAEAKLFSRMVDPERHRKVV 
NIDDPNAAFFVQQGNPNVPVVTFAMENTKADVHPLKFELSLFETQVLVNTPQGILEISSG 
LLGRHNIYNILAAVAVGIAVGAPLEDIVRGVEEVDAVPGRCELIDEEQAFGVIVDHANTP 
DGLSRLLDSIRELKPRRIITVIGCEGENERGKRPLMTKIATEKSDVTMLTSDNPRNEDPL 
DILDDMLSGIGWTMQEYLKHGEHDYYPPLANGHRLFLHDIRRVAVRCAVAMGEEGDMVVV 
AGKGHEAYQLEGEKKEFYDDREECREALQYVDELHQAGIDTSEFPWRLPESH*
>AT5G23535.1 |  KOW domain-containing protein 
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGTIKRVIRSQNRVIVEGKNLIKKHIKGG 
PDHEGGIFTVEAPLHASNVQVVDPVTGRPCKVGVKYLEDGTKVRVARGTGTSGSIIPRPE 
ILKIRATPRPTTAGPKDTPMEFVWEQTYDAKTGKGMPDL*
>AT5G64650.1 |  ribosomal protein L17 family protein 
MTKFRKLGRPAGHRMSMLRTMVSQLVQHERIETTVTKAKEVRRLADNMIQLGKEGSLAAA 
RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR 
QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSDL*
>AT5G64670.1 |  ribosomal protein L15 family protein 
MLRRRLLSIISTSLINSSFHQTAKPRFIISSPLLQCRPSPISTQIPTSTSRALSFQGIRA 
YSLLSLNDLRDNVPRKLKTRKGRGIGSGKGKTAGRGHKGQKARGTMKFGFEGGQTPLRRR 
LPKRGFKNKFKLHFQPVGLGKIAKLINAGKIDSHELITMKTLKDVGAIGKQIEDGVRLMG 
RGADDIKWPLHFEVSRVTVRAKEVVEAAGGSVRRVYYNKLGLRALLKPEWFEKKGRLLPK 
AARPPPKQQDKVDSIGRLPAPKKPIPFFAAEETKVESPVES*