>AT5G41790.1 |  CIP1 (COP1-INTERACTIVE PROTEIN 1) protein binding 
MKKHKFRETLKSFFEPHFDHEKGEMLKGTKTEIDEKVNKILGMVESGDVNEDESNRQVVA 
DLVKEFYSEYQSLYRQYDDLTGEIRKKVNGKGESSSSSSSDSDSDHSSKRKVKRNGNGKV 
EKDVELVTGALKQQIEAANLEIADLKGKLTTTVEEKEAVDSELELALMKLKESEEISSKL 
KLETEKLEDEKSIALSDNRELHQKLEVAGKTETDLNQKLEDIKKERDELQTERDNGIKRF 
QEAEKVAEDWKTTSDQLKDETSNLKQQLEASEQRVSELTSGMNSAEEENKSLSLKVSEIS 
DVIQQGQTTIQELISELGEMKEKYKEKESEHSSLVELHKTHERESSSQVKELEAHIESSE 
KLVADFTQSLNNAEEEKKLLSQKIAELSNEIQEAQNTMQELMSESGQLKESHSVKERELF 
SLRDIHEIHQRDSSTRASELEAQLESSKQQVSDLSASLKAAEEENKAISSKNVETMNKLE 
QTQNTIQELMAELGKLKDSHREKESELSSLVEVHETHQRDSSIHVKELEEQVESSKKLVA 
ELNQTLNNAEEEKKVLSQKIAELSNEIKEAQNTIQELVSESGQLKESHSVKDRDLFSLRD 
IHETHQRESSTRVSELEAQLESSEQRISDLTVDLKDAEEENKAISSKNLEIMDKLEQAQN 
TIKELMDELGELKDRHKEKESELSSLVKSADQQVADMKQSLDNAEEEKKMLSQRILDISN 
EIQEAQKTIQEHMSESEQLKESHGVKERELTGLRDIHETHQRESSTRLSELETQLKLLEQ 
RVVDLSASLNAAEEEKKSLSSMILEITDELKQAQSKVQELVTELAESKDTLTQKENELSS 
FVEVHEAHKRDSSSQVKELEARVESAEEQVKELNQNLNSSEEEKKILSQQISEMSIKIKR 
AESTIQELSSESERLKGSHAEKDNELFSLRDIHETHQRELSTQLRGLEAQLESSEHRVLE 
LSESLKAAEEESRTMSTKISETSDELERTQIMVQELTADSSKLKEQLAEKESKLFLLTEK 
DSKSQVQIKELEATVATLELELESVRARIIDLETEIASKTTVVEQLEAQNREMVARISEL 
EKTMEERGTELSALTQKLEDNDKQSSSSIETLTAEIDGLRAELDSMSVQKEEVEKQMVCK 
SEEASVKIKRLDDEVNGLRQQVASLDSQRAELEIQLEKKSEEISEYLSQITNLKEEIINK 
VKVHESILEEINGLSEKIKGRELELETLGKQRSELDEELRTKKEENVQMHDKINVASSEI 
MALTELINNLKNELDSLQVQKSETEAELEREKQEKSELSNQITDVQKALVEQEAAYNTLE 
EEHKQINELFKETEATLNKVTVDYKEAQRLLEERGKEVTSRDSTIGVHEETMESLRNELE 
MKGDEIETLMEKISNIEVKLRLSNQKLRVTEQVLTEKEEAFRKEEAKHLEEQALLEKNLT 
MTHETYRGMIKEIADKVNITVDGFQSMSEKLTEKQGRYEKTVMEASKILWTATNWVIERN 
HEKEKMNKEIEKKDEEIKKLGGKVREDEKEKEMMKETLMGLGEEKREAIRQLCVWIDHHR 
SRCEYLEEVLSKTVVARGQRRVSQRT*
>AT4G34620.1 |  SSR16 (SMALL SUBUNIT RIBOSOMAL PROTEIN 16) structural constituent of ribosome 
MTVKIRLARLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIK 
YWLSVGAQPTDTVESMLFRAGLIPPKPMVVVGSKNGQKSTSQHVSPITGEILN*
>AT3G03780.1 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.1 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.1 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.2 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.2 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.2 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.3 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.3 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G03780.3 |  AtMS2 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase/ methionine synthase 
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN 
TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI 
VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL 
LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV 
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA 
NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE 
VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL 
DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED 
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV 
FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG 
VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI 
IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA 
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*
>AT3G63490.1 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAA 
VKSVETNKPKGAKGVYWKSAHICSSMGPSIKLNIREMIDFKPPTAN*
>AT3G63490.1 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAA 
VKSVETNKPKGAKGVYWKSAHICSSMGPSIKLNIREMIDFKPPTAN*
>AT3G63490.2 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQSSRRGKLNSEQTKLGLFTFHLGKLILQRKTFS*
>AT3G63490.2 |  ribosomal protein L1 family protein 
MAACATHSSLMLAYAAASTRSQDLTPTPSLFSFASSRPNHLSFPLLLLGGSRDRRCAAID 
RASNHKFIVSAVAAEADLDTEEDLEQTATAVLDPPKPKKGKAALVLKRDRTRSKRFLEIQ 
KLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQT 
VIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILG 
PRGLMPNPKAGTVTANIPQSSRRGKLNSEQTKLGLFTFHLGKLILQRKTFS*
>AT2G33800.1 |  ribosomal protein S5 family protein 
MATASALSSLSSLSLHTRTSSLISSSSTKSIVSFSSFLNRRFSSLTLVKASSTDTETIFF 
EDETPEITANVVFDPPIAPEGFVSPPYFDEGSDETEEEIATAFEELYGPAYSGESMLGKD 
IYVMDSKHKKSSGIGGKPKKDKIRDGFEERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQG 
NVGVGCAKAKEVVAAVQKSAIDARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPASPGT 
GVIAGGAVRIVLEMAGVENALGKQLGSNNALNNARATLAAVQQMRQFRDVAQERGIPMEE 
LWK*
>AT5G23140.1 |  NCLPP7 (NUCLEAR-ENCODED CLP PROTEASE P7) serine-type endopeptidase 
MMRGLVSGAKMLSSTPSSMATSIATGRRSYSLIPMVIEHSSRGERAYDIFSRLLKERIIC 
INGPINDDTSHVVVAQLLYLESENPSKPIHMYLNSPGGHVTAGLAIYDTMQYIRSPISTI 
CLGQAASMASLLLAAGAKGQRRSLPNATVMIHQPSGGYSGQAKDITIHTKQIVRVWDALN 
ELYVKHTGQPLDVVANNMDRDHFMTPEEAKAFGIIDEVIDERPLELVKDAVGNESKDKSS 
S*
>AT4G30690.1 |  translation initiation factor 3 (IF-3) family protein 
MAGITSTVGFNAILAGATKTVSHPVKSKLFGLRLCVPEFSIVSLSPYHHRRCPAITCRYG 
GGGGGGSRFPGDRRGRQKESEDDDSLDISAIRSATVRLIDDQQNMIGLVSKEEAVRRAED 
AELDLVILSPDADPPVVRMMDYSKYRYEQQKRKKEQQKKTTRMDLKELKMGYNIDQHDYS 
VRMRAARKFLQDGDKVKVIVNMKGRENEFRNIAIELLRRFQTEIGELGTEESKNFRDRNL 
FIVLVPNKEVIRKVQEPPPKKKKKPADDKVSAANITATQDI*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.1 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTLCFGVSRLRPRSA 
IVSAQQEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDN 
EWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS 
MSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESF 
LCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNEN 
NLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVK 
TNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADG 
SPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGL 
VNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKI 
IVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQ 
GFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMG 
QTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEE 
EIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIA 
REIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKR 
VRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFIL 
RVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQV 
AISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.4 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKM 
EKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFE 
VKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.3 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRI 
AVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREP 
FIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDD 
DEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKV 
MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS 
GVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAA 
DEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRV 
ELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNS 
QEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLV 
KVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLVSV 
IISILFCYFSFQPNEEHLE*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT2G04270.2 |  RNEE/G (RNASE E/G-LIKE) endoribonuclease 
MIMNGKLKSRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISS 
KSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDEL 
AAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTD 
EQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQC 
DSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILS 
MNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTV 
VNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVV 
KEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLT 
VRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSV 
VQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGI 
LSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRL 
RDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSV 
TFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSH 
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLL 
KKADAIADSSGKKKLTLIPIKKEKTSGKQRR*
>AT3G18680.1 |  aspartate/glutamate/uridylate kinase family protein 
MAIPLPLTSCSPISTSSSISRTSFVPLTLRNRTFFSNQNYSRRVLISCSSSLSSDNGSSP 
DSMNGNGNGNGSSLNGQSSFPRLPSFDGTSKPPLKWRRVLLKVSGEALAGDEEQNIDPKV 
TMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTWAGCSGLDRSSADYIGMLATVMNAIFLQ 
ATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALR 
CAEINAEVVLKATNVDGVFDDDPKRNPNARLLDSLTYQEVTSKDLSVMDMTAITLCQENN 
IPVVVFNLSEPGNIAKAIKGERVGTLIGGTWNSIVTTTS*
>AT4G04350.1 |  EMB2369 (EMBRYO DEFECTIVE 2369) ATP binding / aminoacyl-tRNA ligase/ leucine-tRNA ligase/ nucleotide binding 
MSSHHQILQIRSDPFVLSHCCRHTRLTSSLTLQSPLKQPFSCLPFRWRRSYRGGVRSSTT 
ETHGSKKEALVSETATTSIELKRVYPFHEIEPKWQRYWEDNRIFRTPDDVDTSKPKFYVL 
DMFPYPSGAGLHVGHPLGYTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP 
KTTTLKNIDRFRLQLKSLGFSYDWDRELSTTEPDYYKWTQWIFLQLYKKGLAYQAEVPVN 
WCPALGTVLANEEVVDGVSERGGHPVIRKPMRQWMLKITAYADRLLEDLDELEWPESIKE 
MQRNWIGRSEGAELNFSILDGEGRETDKEITVYTTRPDTLFGATYMVVAPEHQLLSYFVT 
AEQKQQVEEYKDFASRKSDLERTELQKDKTGVFTGCYAKNPANGDAIPIWVADYVLASYG 
TGAIMAVPAHDTRDNEFALKYNIPIKWVVRNEANSSDDAKQVYPGLGIIENSSTLETGLD 
INQLSSKEAALKVIEWAERTGNGKKKVNYKLRDWLFARQRYWGEPIPILILDESGETIAI 
SESELPLTLPELNDFTPTGTGEPPLSKAVSWVNTVDPSTGKPAKRETSTMPQWAGSCWYY 
LRFMDPKNPEALVDKEKEKYWSPVDVYVGGAEHAVLHLLYSRFWHKVLYDIGVVSTKEPF 
KCVINQGIILGEVQYTAWKDQEGNYVSADTEERLNEHQQVTIPEEKVIKSGDHFVLKEDP 
SIRLIPRVYKMSKSRGNVVNPDDVVLEYGADSLRLYEMFMGPFRDSKTWNTSGIEGVHRF 
LARTWRLVIGLPQSDGSFKDGTLVTDDEPTLEQLRTLHKCIAKVTEEIESTRFNTGISGM 
MEFVNAAYKWNNQPRGIIEPFVLLLSPYAPHMAEELWSRLGHPNSLAYESFPKANPDYLK 
NTTIVLPVQINGKTRGTIEVEEGCSEDDAFVLASQDDKLRKYLDGQSIKKRIYVPGKILN 
VILDRTNVKVTTK*
>AT1G74970.1 |  RPS9 (RIBOSOMAL PROTEIN S9) structural constituent of ribosome 
MASITNLASSLSSLSFSSQVSQRPNTISFPRANSVFALPAKSARRASLSITATVSAPPEE 
EEIVELKKYVKSRLPGGFAAQKIIGTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNP 
LWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLGVARALLKVSADHRSPLKKEG 
LLTRDARVVERKKAGLKKARKAPQFSKR*
>AT4G02260.3 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGMGIFVLFSHD*
>AT4G02260.3 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGMGIFVLFSHD*
>AT4G02260.3 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGMGIFVLFSHD*
>AT4G02260.2 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVMLF 
QIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>AT4G02260.2 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVMLF 
QIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>AT4G02260.2 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQLRIVVKPKPSVGVGPLC 
SPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIRT 
EEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIREW 
QEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKMV 
AAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLRE 
QAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTTP 
APQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWRD 
SKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVMLF 
QIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>AT4G02260.1 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQQLRIVVKPKPSVGVGPL 
CSPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIR 
TEEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIRE 
WQEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKM 
VAAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLR 
EQAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTT 
PAPQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWR 
DSKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVML 
FQIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>AT4G02260.1 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQQLRIVVKPKPSVGVGPL 
CSPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIR 
TEEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIRE 
WQEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKM 
VAAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLR 
EQAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTT 
PAPQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWR 
DSKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVML 
FQIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>AT4G02260.1 |  RSH1 (RELA-SPOT HOMOLOG 1) catalytic 
MTSASSMSVSVECVNICNLTKGDGNARSDCSALSCAWKAPRALTGFLASTAHPPVCSVYS 
CGRNGRKSRMKACAWQRYEYEVGFSEAPYFVNVRNILKSRLSCGGHKRWELYCVSAESSS 
GASSDVTVETLWEDLFPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGEPFIIHPVAVA 
RILGELELDWESIVAGLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCK 
TESETIQDVKADDLRQMFLAMTDEVRVIIVKLADRLHNMRTLCHMPPHKQSSIAGETLQV 
FAPLAKLLGMYSIKSELENLSFMYVSAEDYDRVTSRIANLYKEHEKELTEANRILVKKIE 
DDQFLDLVTVNTDVRSVCKETYSIYKAALKSKGSINDYNQIAQQLRIVVKPKPSVGVGPL 
CSPQQICYHVLGLVHEIWKPIPRTVKDYIATPKPNGYQSLHTTVIPFLYESMFRLEVQIR 
TEEMDLIAERGIAVYYNGKSLSTGLVGNAVPLGRNSRGKTGCLNNADFALRVGWLNAIRE 
WQEEFVGNMSSREFVDTITRDLLGSRVFVFTPKGEIKNLPKGATVVDYAYLIHTEIGNKM 
VAAKVNGNLVSPTHVLENAEVVEIVTYNALSSKSAFQRHKQWLQHAKTRSARHKIMRFLR 
EQAAQCAAEITQDQVNDFVADSDSDVEDLTEDSRKSLQWWEKILVNVKQFQSQDKSRDTT 
PAPQNGSVWAPKVNGKHNKAIKNSSSDEPEFLLPGDGIARILPANIPAYKEVLPGLDSWR 
DSKIATWHHLEGQSIEWLCVVSMDRKGIIAEVTTVLAAEGIALCSCVAEIDRGRGLAVML 
FQIEANIESLVSVCAKVDLVLGVLGWSSGCSWPRSTENAQVLEC*
>ATCG00180.1 |  RNA polymerase beta subunit-1 
MIDRYKHQQLRIGLVSPQQISAWATKIIPNGEIVGEVTKPYTFHYKTNKPEKDGLFCERI 
FGPIKSGICACGNYRVIGDEKEDPKFCEQCGVEFVDSRIRRYQMGYIKLTCPVTHVWYLK 
RLPSYIANLLDKPLKELEGLVYCDFSFARPITKKPTFLRLRGSFEYEIQSWKYSIPLFFT 
TQGFDIFRNREISTGAGAIREQLADLDLRIIIENSLVEWKQLGEEGPTGNEWEDRKIVRR 
KDFLVRRMELAKHFIRTNIEPEWMVLCLLPVLPPELRPIIQIEGGKLMSSDINELYRRVI 
YRNNTLTDLLTTSRSTPGELVMCQEKLVQEAVDTLLDNGIRGQPMRDGHNKVYKSFSDVI 
EGKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLA 
SNIGVAKSQIREKKPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILVEGRTICLHP 
LVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDMLIGLY 
VLTSGTRRGICANRYNPCNRKNYQNERIYETNYKYTKEPFFCNSYDAIGAYRQKKINLDS 
PLWLRWQLDQRVIASREVPIEVHYESFGNYHEIYAHYLIVRSVKKENFCIYIRTTVGHIS 
FYREIEEAIQGFSQACSYDT*
>ATCG00740.1 |  RNA polymerase alpha subunit 
MVREKVKVSTRTLQWKCVESKRDSKRLYYGRFILSPLMKGQADTIGIAMRRALLGEIEGT 
CITRAKSENIPHDYSNIAGIQESVHEILMNLNEIVLRSNLYGTRNALICVQGPGYITARD 
IILPPAVEIIDNTQHIATLTEPIDLCIELKIERNRGYSLKMSNNFEDRSYPIDAVFMPVE 
NANHSIHSYGNGNEKQEILFLEIWTNGSLTPKEALHQASRNLINLFIPFLHVEEETFYLE 
NNQHQVTLPFFPFHNRLVNLRKKKKTKELAFQYIFIDQLELPPRIYNCLKKSNIHTLLDL 
LNNSQEDLIKIEHFHVEDVKKILDILEKK*
>ATCG00380.1 |  Chloroplast encoded ribosomal protein S4 
MSRYRGPRFKKIRRLGALPGLTSKRPKAGSDLRNQSRSVKKSQYRIRLEEKQKLRFHYGL 
TEHQLLKYVRIAGKAKGSTGQVLLQLLEMRLDNILFRLGMALTIPQARQLVNHGHILVNG 
RIVDIPSYRCKPRDIITVKDEQNSRTLVQNLLDSSAPEELPNHLTLHTFQYEGLVNQIID 
RKCVGLKINELLVVEYYSRQT*
>ATCG00800.1 |  encodes a chloroplast ribosomal protein S3 a constituent of the small subunit of the ribosomal complex 
MGQKINPLGFRLGTTQSHHSLWFAQPKKYSEGLEEDKKIRDCIKNYVQKNIRISSGMEGI 
ARIEIQKRIDLIQIIIYMGFPKLLIEDKPRRVEELQMNVQKELNCVNRKLNIAITRISNP 
YGDPNILAEFIAGQLKNRVSFRKAMKKAIELTEQANTKGIQVQIAGRIDGKEIARVEWIR 
EGRVPLQTIEAKIDYCSYTVRTIYGVLGIKIWIFVDEE*
>ATCG00830.1 |  encodes a chloroplast ribosomal protein L2 a constituent of the large subunit of the ribosomal complex 
MAIHLYKTSTPSTRNGAVDSQVKSNPRNNLICGQHHCGKGRNARGIITARHRGGGHKRLY 
RKIDFRRNAKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEV 
PIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVR 
LISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIG 
RKKPVTPWGYPALGRRTRKRKKYSETLILRRRSK*
>ATCG01240.1 |  30S chloroplast ribosomal protein S7 
MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLS 
VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 
SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR*
>AT4G37910.1 |  mtHsc70-1 (mitochondrial heat shock protein 70-1) ATP binding 
MASVALLRSFRRREVQMASVSAFKSVSANGKNSMFGKLGYLARPFCSRPVGNDVIGIDLG 
TTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPTNTIFGSK 
RLIGRRFDDPQTQKEMKMVPYKIVKAPNGDAWVEANGQKFSPSQIGANVLTKMKETAEAY 
LGKSINKAVVTVPAYFNDAQRQATKDAGKIAGLDVQRIINEPTAAALSYGMNNKEGVIAV 
FDLGGGTFDVSILEISSGVFEVKATNGDTFLGGEDFDNTLLEYLVNEFKRSDNIDLTKDN 
LALQRLREAAEKAKIELSSTTQTEINLPFITADASGAKHLNITLTRSKFEGLVGKLIERT 
RSPCQNCLKDAGVTIKEVDEVLLVGGMTRVPKVQEIVSEIFGKSPCKGVNPDEAVAMGAA 
IQGGILRGDVKDLLLLDVVPLSLGIETLGAVFTKLIPRNTTIPTKKSQVFSTAADNQMQV 
GIKVLQGEREMAADNKVLGEFDLVGIPPAPRGMPQIEVTFDIDANGITTVSAKDKATGKE 
QNITIRSSGGLSDDEINRMVKEAELNAQKDQEKKQLIDLRNSADTTIYSVEKSLSEYREK 
IPAEIASEIETAVSDLRTAMAGEDVEDIKAKVEAANKAVSKIGEHMSKGSGSSGSDGSSG 
EGTSGTEQTPEAEFEEASGSRK*
>AT2G42520.1 |  DEAD box RNA helicase putative 
MSASWADVADSENTGSGSSNQNSHPSRPAYVPPHLRNRPAASEPVAPLPANDRVGYGGPP 
SGSRWAPGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGWDRREREVNPFEN 
DDSEPEPAFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIRRCKYV 
KPTPVQRHAIPILLEGRDLMACAQTGSGKTAAFCFPIISGIMKDQHVQRPRGSRTVYPLA 
VILSPTRELASQIHDEAKKFSYQTGVKVVVAYGGTPINQQLRELERGVDILVATPGRLND 
LLERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSATFPREI 
QRLAADFLANYIFLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQAL 
TLVFVETKRGADSLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAAR 
GLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNDGNTSLARPLAELMQEA 
NQEVPEWLTRYASRSSFGGGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGY 
GGGGGYGGGGGYGGGYGGASSGGYGGEPPSAWD*
>AT3G09210.1 |  PTAC13 (PLASTID TRANSCRIPTIONALLY ACTIVE13) transcription elongation regulator 
MMKLQGGLLQWSRSSLIPSIYTPINKTQFSIAACVIERNHQLTAKERRQLRNERRESKLG 
YSWREEVEEKLIKKPKKRYATWTEELNLDTLAESGPQWWAVRVSRLRGHETAQILARALA 
RQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFIRCILNKEIHDSIRDVDGVGG 
FIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEADRAEEEASILASQEL 
LALSNSDVIETVAESKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKL 
NRKTAKATVGFTLFGKETLVEIDINELVPEIQS*
>AT3G03600.1 |  RPS2 (RIBOSOMAL PROTEIN S2) structural constituent of ribosome 
MTIHAAVIQKLLNTGAHLGRRAAEHHFKQYAYGTRNGMTIIDSDKTLICLRSAAHFVANL 
AHMRGNIFFVNTNPLFDEIIELTSRRIQGDSYNHNRAMNLWKMGGFLTNSYSPKKFRSRH 
KKLCFGPTTMPDCVVVFDSERKSSVILEASKLQIPVVAIVDPNVPLEFFEKITYPVPARD 
SVKFVYLFCNVITKCFVAEQMKLGIKEGSNEDLMKDLAA*
>AT2G45240.1 |  MAP1A (METHIONINE AMINOPEPTIDASE 1A) aminopeptidase/ metalloexopeptidase 
MASESDASSIATLSCARCEKPAHLQCPKCIDLKLPREQASFCTQECFKAAWSSHKSVHVK 
AQLSSIGDQNSDLISQGWLYCVKKGQARTPKLPHFDWTGPLKQYPISTKRVVPAEIEKPD 
WAIDGTPKVEPNSDLQHVVEIKTPEQIQRMRETCKIAREVLDAAARVIHPGVTTDEIDRV 
VHEATIAAGGYPSPLNYYFFPKSCCTSVNEVICHGIPDARKLEDGDIVNVDVTVCYKGCH 
GDLNETYFVGNVDEASRQLVKCTYECLEKAIAIVKPGVRFREIGEIVNRHATMSGLSVVR 
SYCGHGIGDLFHCAPNIPHYARNKAVGVMKAGQTFTIEPMINAGGWRDRTWPDGWTAVTA 
DGKRSAQFEHTLLVTETGVEVLTARLPSSPDVYPWLTK*
>AT2G20060.1 |  ribosomal protein L4 family protein 
MAASISRRIFRTFGSFSALGRSSSPNLSANTSGNGLASLTNDLKYGMALLSNRKLSTSIL 
TPDDSFPSDLLTKKTVLTPDRTIGQYQDLVIPVTNFQNEEKGFMVLAGDVFDVPIRKDII 
HNVVRWQLAKRQQGTHSTKTLSEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPK 
PRSHAIKMNKQVRRLGLKIALTARAAEGKLLVFDDLGLPTHKTKNIVNYYNQMENTKKVL 
VVEGGPIDEKLKLATQNLHYVNIIPSIGLNVYSILLHDTLLMSRDAVNKIVERMHTPINR 
*
>AT3G49080.1 |  ribosomal protein S9 family protein 
MLSRLFLRHSNLRFVTLVSSKSNSQIFSSFIRPLSTNSSGGGGNGDGNGRNRNDVPWSFT 
GVNDDKSGPFSSDDSFGSSGVAGSGLPGGEGKWPEEPKRWNIKEEEEKVVFDTGGEVGQG 
IETSRERRGNEWEETKRWDMKEGEEKVVFGGGGDEVDGFGIRGEVKSNEWDVSKPWNLKE 
EEEGVVFDTGGEVPFSFENSLEMAEEERVKKELIEKEEKELLEVIKGPDRAFGDLIAKSG 
ITDEMLDSLIALKDFQGVEGLPPLTEIENLRREKSSKKSSRAEIELQMQEDIAKARVRQV 
DETGRAYGTGRRKCSIARVWIQPGEGKFQVNEKEFDVYFPMLDHRAALLRPLAETKTLGR 
WDIKCTVKGGGTTGQVGAIQLGISRALQNWEPDMRTSLRAAGFLTRDSRVVERKKPGKAK 
ARKSFQWVKR*
>AT2G17510.1 |  EMB2763 (EMBRYO DEFECTIVE 2763) RNA binding / ribonuclease 
MLQSKVFNKKTRGGRIQKQVREVYLRDDIYCGAFSCKSCDSSAARLSSSKIIVVDTNVVL 
HQIDLLENKAIDTVVVLSVVLDEVKNRNRSVYNRIRLLCSNPARQFYVFSNHVHKDTYVQ 
AMEKESANDHNDRAIRVATLWYQKHLGDTSQVLLVTNDRENKRKATEEGISAETIEAYVK 
SLGQPELLDLLAQPTNEDITMEDADDSRPSKRKLIYQEHKPMSEITAGLHRGIYHQGKLR 
VNRFNPYEAYVGSESIGEEIIIYGRSNMNRAFDGDIVAVELLPRDQWQDEKALSIAEEDD 
EEDDTVHLAPDNVDDAPRTSNLSHETSGDKNAAPVRPSGRVVGVIRRNWHSYCGSLEPMS 
LPAGSGGTAHALFVSKDRRIPKIRINTRQLQNLLDMRIVVAVDSWDRQSRYPSGHYVRPI 
GKIGDKETETEVVLIENDVDYSPFSSQVLACLPPLPWSVSSEDVSNPVRQDLRHLLVFSV 
DPPGCKDIDDALHCTSLPNGNFELGVHIADVTNFVHPGTPLDDEASKRGTSVYLVERRID 
MLPKPLTEDICSLRADVERLAFSVIWEMSPDAEIISTRFTKSIIKSSAALSYIEAQARMD 
DSRLTDSLTTDLRNMNTLAKIMRQRRIDRGALTLASAEVKFDIDPENHDPLNIGMYQILE 
ANQMVEEFMLAANVSVAGQILKLFPSCSLLRRHPTPTREMLEPLLRTAAAIGLTLDVSSS 
KALADSLDRAVGEDPYFNKLIRILATRCMTQAVYFCSGDLSPPEYHHYGLAAPLYTHFTS 
PIRRYADVFVHRLLAASLGIYKLPTVFQDRPQLTSVADNLNYRHRNAQMAGRASVELYVL 
IYFRTRPTDEEARVVKIRSNGFIVFVPKYGIEGPVYLTGKGEKGAGDWYVDEEKQKIVKM 
DGSLSYSVLQTVKIHMEVVEPQPNRPKLQLTLL*
>AT2G39140.1 |  SVR1 (SUPPRESSOR OF VARIEGATION 1) RNA binding / pseudouridine synthase 
MASVAASSSISFAASFLKIKAFPLSPRFFPIRTLRCSVSSSSSEPIEFDISFAPPKPKPS 
STHGGVTPQQLFIPWIVRSDDGTLKLQSQPPARLIHNLAIDATTQNPKKKDKSKKKQPQA 
TSSSSATTTASSPASHSEVKPKLSKAARRFYNENFKEQPQRLSKVLAAAGVASRRTSEEL 
IFDGKVTVNGILCNTPQTRVDPSRDIIYVNGNRIPKKLPPKVYFALNKPKGYICSSGEKE 
IKSAISLFDEYLSSWDKRNPGTPKPRLFTVGRLDVATTGLIVVTNDGDFAQKLSHPSSSL 
PKEYITTVVGDIHKRHLMAISEGTMVEGVHCVPDSVELMPKQHDIPRARLRIVVHEGRNH 
EVRELVKNAGLEVHSLKRVRIGGFRLPSDLGLGKHVELKQSELKALGWKN*
>AT3G22310.1 |  PMH1 (PUTATIVE MITOCHONDRIAL RNA HELICASE 1) ATP-dependent helicase/ DNA binding / RNA binding 
MISTVLRRSILGTSRRTLAASVTSINAALFHNLAPAAATVSDLANGATNVKSLPSNSSPF 
GVKVRDFHVKSVPSEFRSSIVSSAGFAAQEYAPSYENDGGIGDSESVGSSGGGDGLAIAD 
LGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAFGIPIIDKIIK 
FNAKHGRGKNPQCLVLAPTRELARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGID 
VAVGTPGRIIDLMKRGALNLSEVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFS 
ATMPSWIRSLTKKYLNNPLTIDLVGDSDQKLADGITMYSIAADSYGRASIIGPLVKEHGK 
GGKCIVFTQTKRDADRLAFGLAKSYKCEALHGDISQAQRERTLAGFRDGNFSILVATDVA 
ARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGSAILIHGQDQTRAVKMIEKEVG 
SRFNELPSIAVERGSASMFEGVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGG 
SSGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGGSSGGFGSDRSSQSSGRSSFGG 
FGSNDGKRSY*
>AT4G21220.1 |  bacterial transferase hexapeptide repeat-containing protein 
MAATLWRLYSKSICNSLQGIILNKPFIQKQLLLSSRTRSLSFSSDSQFGSATAEVCSNTG 
LKTGGGIIVKEGFLRWENGGGTCHSSAQIYSSALVEFGAVVHEKAVLGAEVHVGSGTVIG 
PSVDIGPSTRIGYNVSISNCSIGDSCVIHNGVCIGQDGFGFYVDEHGNMVKKPQTLNVKI 
GNRVEIGANTCIDRGSWRETVIEDDTKIDNLVQIGHNVIIGKCCLLCGQVGIAGSVTIGD 
YVALGGRAAVRDHVSIVSKVRLAANSCVTRNITEPGDFGGFPAVPIHEWRKQIVRAQIAN 
KREI*
>AT5G51140.1 |  pseudouridine synthase family protein 
MKRKQQEDDNDDGVEKAVSPVLATTSNTMSTDLLLQSSSKLSQKQDYIFHGGRRHVRPYY 
FEFISHVNKRWTGKTIVDLFADEFKGRPRDYYVGAVKSGRIKVDGEIVPVSYIVKSSQKI 
THFLHRHEPPVMIDDVVILHQEPDVVTVCKPASVPVHPCGQYRKNTIVGILDAEHDLGTL 
FPIHRLDRLVSGLLIIARTAAKADFFRQQIEGGMVKKRYIAKVIGVFPEDEMIVDANINY 
NGSEGRSTAEDANSSGDDKKVKGKPACTKFTRIDTNGTHSLVSCEPVTGRTHQIRVHLQY 
TGHPIANDPLYLNQHIDNLETYIAKRIDAGERKIVSPDDYVYSSEDFSIDPMCTNCPKLI 
PQGYEEHDEALWLHCVQYCGTGWEYECPYPSWASL*
>AT5G64650.1 |  ribosomal protein L17 family protein 
MTKFRKLGRPAGHRMSMLRTMVSQLVQHERIETTVTKAKEVRRLADNMIQLGKEGSLAAA 
RRAAGFVRGDDVLHKIFTELAHRYKDRAGGYTRMLRTRIRVGDAAPMAYIEFIDRENELR 
QSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTSDSDL*
>AT2G36930.1 |  zinc finger (C2H2 type) family protein 
MGRCPTRKVKKRRLSHKTARRDKFEVKGDDLVYTELRKPETEIKPLQLDEDLPGMGQFYC 
LHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGPKLMSNLV 
FTELRKPETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVKKIERPAPHSQLDA 
DLAGGMGMPDNGPKLMSA*
>AT2G30650.1 |  catalytic 
MASHSQVLVEEKSSVRILTFNRPKQLNALSFHMVSRLLQLFLAYEEDPSVKLVVLKGQGR 
AFSAGGDIPPIVRDILQGKLIRGAHYFKVGYTLNYVLSTYRKPQVSILNGIVMGGGAGLS 
TNGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACG 
LATHFVPSISLTALEAELYKVGSSNQTFISTILDAYAEYPHLNQHSSYHRLDVIDRCFSK 
RTVEEIFSALEREVTQKPNDWLLATIQALEKASPSCLKISLRSIREGRLQGVGQCLIREY 
RMVCHVMKGDISKDFVEGCRAVLIDKDRNPKWQPRRLEDVTDSMVDQYFERVEDEEGWED 
LKFPPRNNLPALAIAAKL*
>AT1G49400.1 |  emb1129 (embryo defective 1129) structural constituent of ribosome 
MKPVIGTVVSNKMQKSVVVAVDRLFHNKIYNRYVKRTSKFMAHDDKDACNIGDRVKLDPS 
RPLSKNKHWIVAEIIKKARIYSPKAAAAAVSASASASSASTTDSSAQSQIPPSSTS*
>AT1G15810.1 |  ribosomal protein S15 family protein 
MALHLARRHQRLPSNTSLIRFFSNSSSDSPPQFTNAPVEKPSQSPSSPSPSDSSPIFDIK 
NTLKLKLQNQQEQGRKPFDRSDAQSQNRGSTSFSQNLGKNLAKFQRRSTVPPPRDSGGVQ 
PPSYISLAGLYKQSAATNSSDPRNSKAQGFNSNTVSETLKNLRTQINTSNNMGKRGGVLG 
SFKSTVGEALPKYLFETQMDESKGSEGETEEAMTEFLMFYNEEELGEKLRTLRPEGEKKE 
GWFSLEELNQRLVKLRQVEEKEAQYRTKNFAQLRNVISSFKNENSEASSQQNVAIMGHLG 
GIPEYKLLPPKEDLVDTYFHPDNMSSAEKMKIELSKVREEFKMSESDCGSARVQVAQLTT 
KIKHLSSSLHKKDKHSRKGLLGMVQKRKKLLKYLRRTDWDSYCLVLSKLSLRDNPDYKC*
>AT1G64600.1 |  copper ion binding / methyltransferase 
MANAQKVFTVETLRSASKQCLRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEI 
KDTNLQLPETTAKSLADSMNSLETKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVFSVC 
YRVLIEIRRRVPGFTPTRVLDFGAGTGSGFWAVKEVWPKSVEKVNIVEPSQSMQRAGRNL 
IQGLKDLPLIHGYTSLLALNKEINKKSERKHDLVIASYVLGEIPSLKDRITVVRQLWDLT 
DDLLVLVEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKDGKEVLDLKSGAHIVAPC 
PHDGKCPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVAFRRGQRPREL 
WPLDGMKLETLKERRANKKPEDLEIDYEDFIKSQVVEVPYIDPRAYDSDTMDENEEEQED 
GGGTDEDEEDKIEEEIEEESERASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAF 
ERRVITKSKNPDLHLQAKKSFWGDLWPLTTQQENGKKKQVDAEWCRPDEDQKWSGWP*
>AT1G14400.1 |  UBC1 (UBIQUITIN CARRIER PROTEIN 1) ubiquitin-protein ligase 
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 
PANSEAARMYSESKREYNRRVRDVVEQSWTAD*
>AT1G14400.1 |  UBC1 (UBIQUITIN CARRIER PROTEIN 1) ubiquitin-protein ligase 
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 
PANSEAARMYSESKREYNRRVRDVVEQSWTAD*
>AT1G14400.2 |  UBC1 (UBIQUITIN CARRIER PROTEIN 1) ubiquitin-protein ligase 
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 
PANSEAARMYSESKREYNRRVRDVVEQSWTAD*
>AT1G14400.2 |  UBC1 (UBIQUITIN CARRIER PROTEIN 1) ubiquitin-protein ligase 
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 
PANSEAARMYSESKREYNRRVRDVVEQSWTAD*
>AT1G28350.1 |  ATP binding / aminoacyl-tRNA ligase/ nucleotide binding / tyrosine-tRNA ligase 
MEALSINAPTQASTLPSGLQISKEVEKRYNVVRSVGEQCIHDDELKDLLAKKAAPVCYDG 
FEPSGRMHIAQLALEFFYVLSSLSEKLLLARLTLLLPWQGLMKIMNVNKLTSAGCRVKIW 
IADWFAYMNNKLGGDLKKIRVVGEYFKEIFQAAGMNSENVEFLWSSDEINAKGDEYWPLV 
MDIACRNSLAQIKRCMPIMGLSENEELSAAHILYVCMQCADTFFLEADICQLGMDQQTVN 
LLARDYCDVVKRENKPVILSHHMLPGLQQGQKKMSKSDPSSAIFMEDEEAEVNVKIKKAY 
CPPDIVEGNPCLEYVKHIILPWFSEFTVERDEKYGGNRTFKSFEDITTDYESGQLHPKDL 
KDALSKALNKILQPVRDHFKTNSRAKNLLKQVKGYKVTRVIPTASSTKEEDLSINTSASS 
SAAGLQMSEEAEMKYKIVRSIGEECIQEDELKNLLAKKPAPICYDGFEPSGRMHIAQGVM 
KVTNVNKLTSAGCQVKIWIADWFAQLNNKLGGDLERIRVVGEYFKEIWQAGGMNNDKVEF 
LWASDEINGKGSKYWPLVMDIARRNNLRRILRCGQIMGRSETEVLSAAQILYPCMQCADI 
FLLEADICQLGMDQRKVNMLAREYCADIKRKNKPIILSHHMLPGLQQGQEKMSKSDPSSA 
IFMEDEEADVNEKISKAYCPPKTVEGNPCLEYVKYIVLPRFNEFKVESEKNGGNKTFNSF 
EDIVADYETGELHPEDLKKALMKALNITLQPVRDHFKTNERAKNLLEQVKAFRVTR*