>AT5G63920.1 |  DNA topoisomerase III alpha putative 
MSRRGGGPVTVLNVAEKPSVAKSVAGILSRGTFRTREGRSRYNKIFEFDYAINGQPCRML 
MTSVIGHLMELEFADRYRKWHSCDPADLYQAPVMKHVPEDKKDIKKTLEEEARKSDWLVL 
WLDCDREGENIAFEVVDVCRAVKHNLFIRRAHFSALIDRDIHEAVQNLRDPNQLFAEAVD 
ARQEIDLRIGASFTRFQTMLLRDRFAIDSTGEERSRVISYGPCQFPTLGFIVERYWEIQA 
HEPEEFWTINCSHQSEEGLATFNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERF 
KYPPYPLNTIELEKRASRYFRLSSEHTMKVAEELYQAGFISYPRTETDSFSSRTDLRAMV 
EEQTRHPAWGSYAQRLLEPEGGLWRNPANGGHDDKAHPPIHPTKFSSGESNWSRDHLNVY 
ELVVRHYLACVSQPAVAAETTVEIDIAGERFSASGRAILAKNYLEVYRFESWGGSVIPVY 
EKGQQFIPTTLTLDAAVTRPPPLLCEADLLSCMDKAGIGTDATMHDHIKKLLDRGYATKD 
ANTRFSPTNLGEALVMGYDDMGYELWKPNLRALMEHDMNEVSVGRKTKAEVLETCLQQMK 
ACFLDARVKKSKLLEAMTIFFERSNNTDESESQTAGEVVRRCNLCNESDMALRKNRDGNF 
MVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLG 
CVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNC 
PSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFA 
WEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGI 
RCFSCGDPSHFANACPNRNNSNGNYF*
>AT3G11630.1 |  2-cys peroxiredoxin chloroplast (BAS1) 
MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSR 
RSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCP 
TEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSIS 
KSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEV 
CPAGWKPGEKSMKPDPKLSKEYFSAI*
>AT4G02070.1 |  MSH6 (MUTS HOMOLOG 6) damaged DNA binding 
MAPSRRQISGRSPLVNQQRQITSFFGKSASSSSSPSPSPSPSLSNKKTPKSNNPNPKSPS 
PSPSPPKKTPKLNPNPSSNLPARSPSPGPDTPSPVQSKFKKPLLVIGQTPSPPQSVVITY 
GDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVVEYEDGEEESLDLGKEKTEWVVGEK 
SGDRFNRLKRGASALRKVVTDSDDDVEMGNVEEDKSDGDDSSDEDWGKNVGKEVCESEED 
DVELVDENEMDEEELVEEKDEETSKVNRVSKTDSRKRKTSEVTKSGGEKKSKTDTGTILK 
GFKASVVEPAKKIGQADRVVKGLEDNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPT 
DENYDPRTLYLPPDFVKKLTGGQRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKEL 
DIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVK 
REVCAVVTKGTLTDGEMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIIL 
GQFKDDQDCSALSCLLSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDS 
EKTIYEVGIIYKRINCQPSSAYSSEGKILGDGSSFLPKMLSELATEDKNGSLALSALGGA 
IYYLRQAFLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGT 
LYAQLNQCITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSRLP 
DMERLIARMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAILKH 
DTSRRLLHLLTPGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTVEE 
FESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSRYW 
TPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFAS 
DSYEGVRCRPVISGSTSDGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFIL 
LTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQSTFL 
TELSETAVMLTSATRNSLVVLDELGRGTATSDGQAIAESVLEHFIEKVQCRGFFSTHYHR 
LSVDYQTNPKVSLCHMACQIGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVL 
QRAVIKSQEFEALYGKNHRKTDHKLAAMIKQIISSVASDSDYSASKDSLCELHSMANTFL 
RLTN*
>AT1G02680.1 |  TAF13 (TBP-ASSOCIATED FACTOR 13) DNA binding / RNA polymerase II transcription factor 
MSNTPAAAASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIV 
VEYVTDLTHKAQEIGSKRGRLLVDDFLYLIRKDLPKLNRCRELLAMQEELKQARKAFDVD 
EKELVD*
>AT3G13940.1 |  DNA binding / DNA-directed RNA polymerase 
MEGEEKNDYRNEEEDFNTPQQLQKKQRKGKKIATETEDENEEDKRVTLKVTQVAERPDRI 
SPIVAYFSTGYDPCKVDPKTGKRVHETPKVTVYKHKDDSKKRIQVVVSPPGARVEFVGTN 
YTGEQAAMQTNTYRVGVFNREAKTLRILPVAHNKIIRLEPRVKAQETNEEEASGSAVVKE 
LEELKTGERDRYNTKKAVTRDKKKRALYMGDDAATQKVLDGKLSELGVNTAALEGTSSTV 
ARNIPPYNTAATTANEAYPLEKIIEKGDWSFLEDIYWLLQQETEAATEAYPVFVRNRLYR 
LRDIKDDMKKQTVCGAATLLTHLVKFKDRNSMNGYDSAKDHKMPDIFRQKFNSMFKDSES 
DRIPVDKINLLISYVLVLSLHVDNFMTDPEDIAKDLRISTVELRKHFLQLGCKFLKQNST 
TVATLPTPLNFPEVNRRRRARK*
>AT5G09860.1 |  nuclear matrix protein-related 
MDAFRDAILQRAPIETFALKTVQHFIQPQKQTKLAQDENQMLENMLRTLLQELVAAAAQS 
GEQIMQYGQLIDDDDDDDDIHGQIPHLLDVVLYLCEKEHVEGGMIFQLLEDLTEMSTMKN 
CKDVFGYIESKQDILGKQELFARGKLVMLRTCNQLLRRLSKANDVVFCGRILMFLAHFFP 
LSERSAVNIKGVFNTSNETKYEKDPPKGISVDFNFYKTFWSLQEYFCNPASLTSASTKWQ 
KFSSSLAVVLNTFDAQPLSEEEGEANSLEEEAATFNIKYLTSSKLMGLELKDSSFRRHIL 
LQCLIMFDYLRAPGKNDKDLPSETMKEELKSCEDRVKKLLEITPPKGKEFLRAVEHILER 
EKNWVWWKRDGCPPFEKQPIDKKSPNAGQKKRRQRWRLGNKELSQLWRWADQNPNALTDS 
QRVRTPDIADYWKPLAEDMDPSAGIEDEYHHKNNRVYCWKGLRFTARQDLEGFSRFTEMG 
IEGVVPVELLPPEVRSKYQAKPNEKAKRAKKEETKGGSHETEGNQIGVSNSEAEAEGGRG 
DAETMESDAIADTPTPEEQQRLGGSDTENGQEAGQIEDGETEEAGLMDTDLDHPPMPVS*
>AT1G05120.1 |  SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein 
MELRSRNKAIRPSTEVVDLEEGTGINPDEEPYAISSDDDSIGSEFQGDEEEEEELEEVVA 
NDDLPNPVPVLAIVNLPRASKKRKKPDARKEKVVLLWETWEKEQNSWIDEHMSEDVDLDQ 
HNAVIAETAEPPSDLIMPLLRYQKEFLAWATKQEQSVAGGILADEMGMGKTIQAISLVLA 
RREVDRAQFGEAAGCTLVLCPLVAVSQWLNEIARFTSPGSTKVLVYHGAKRAKNIKEFMN 
YDFVLTTYSTVESEYRRNIMPSKVQCAYCSKSFYPKKLVIHLRYFCGPSAVKTAKQSKQK 
RKKTSDSSSQQGKEADAGEDKKLKKSKKKTKQTVEKDQLGSDDKEKSLLHSVKWNRIILD 
EAHYIKERRSNTARAVFALEATYRWALSGTPLQNRVGELYSLIRFLQIRPYSYYFCKDCD 
CRILDYVAHQSCPHCPHNAVRHFCWWNKYVAKPITVYGSFGLGKRAMILLKHKVLKDILL 
RRTKLGRAADLALPPRIITLRRDTLDVKEFDYYESLYKNSQAEFNTYIEAGTLMNNYAHI 
FDLLTRLRQAVDHPYLVVYSNSSGANANLVDENKSEQECGLCHDPAEDYVVTSCAHVFCK 
ACLIGFSASLGKVTCPTCSKLLTVDWTTKADTEHKASKTTLKGFRASSILNRIKLDDFQT 
STKIEALREEIRFMVERDGSAKAIVFSQFTSFLDLINYTLGKCGVSCVQLVGSMTMAARD 
TAINKFKEDPDCRVFLMSLKAGGVALNLTVASHVFMMDPWWNPAVERQAQDRIHRIGQYK 
PIRVVRFIIENTVEERILRLQKKKELVFEGTVGGSQEAIGKLTEEDMRFLFTT*
>AT1G07370.1 |  PCNA1 (PROLIFERATING CELLULAR NUCLEAR ANTIGEN) DNA binding / DNA polymerase processivity factor/ protein binding 
MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHY 
RCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMD 
IDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANI 
VLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYK 
VAEMGYIRYYLAPKIEEEEDTNP*
>AT3G19210.1 |  ATRAD54 (ARABIDOPSIS HOMOLOG OF RAD54) ATP binding / DNA binding / helicase/ nucleic acid binding 
MEEEDEEILSSSDCDDSSDSYKDDSQDSEGENDNPECEDLAVVSLSSDADRKSKNVKDLL 
RGNLVVQRQPLLPRVLSVSDGAAVCRKPFKPPCSHGYDSTGQLSRRLSARKRFVPWGSST 
PVVVALPTKLEASTNIERDEEEEVVCLPPDIEPLVLWQSEEDGMSNVTTIMVHSVLVKFL 
RPHQREGVQFMFDCVSGLHGSANINGCILADDMGLGKTLQSITLLYTLLCQGFDGTPMVK 
KAIIVTPTSLVSNWEAEIKKWVGDRIQLIALCESTRDDVLSGIDSFTRPRSALQVLIISY 
ETFRMHSSKFCQSESCDLLICDEAHRLKNDQTLTNRALASLTCKRRVLLSGTPMQNDLEE 
FFAMVNFTNPGSLGDAAHFRHYYEAPIICGREPTATEEEKNLAADRSAELSSKVNQFILR 
RTNALLSNHLPPKIIEVVCCKMTTLQSTLYNHFISSKNLKRALADNAKQTKVLAYITALK 
KLCNHPKLIYDTIKSGNPGTVGFENCLEFFPAEMFSGRSGAWTGGDGAWVELSGKMHVLS 
RLLANLRRKTDDRIVLVSNYTQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNRLNDP 
TKDEFAFLLSSKAGGCGLNLIGANRLVLFDPDWNPANDKQAAARVWRDGQKKRVYVYRFL 
STGTIEEKVYQRQMSKEGLQKVIQHEQTDNSTRQGNLLSTEDLRDLFSFHGDVRSEIHEK 
MSCSRCQNDASGTENIEEGNENNVDDNACQIDQEDIGGFAKDAGCFNLLKNSERQVGTPL 
EEDLGSWGHHFTSKSVPDAILQASAGDEVTFVFTNQVDGKLVPIESNVSPKTVESEEHNR 
NQPVNKRAFNKPQQRPREPLQPLSLNETTKRVKLSTYKRLHGNSNIDDAQIKMSLQRPNL 
VSVNHDDDFV*
>AT1G63490.1 |  transcription factor jumonji (jmjC) domain-containing protein 
MYGNDLDTSVYGSGFPRIGDQRPESVEADIWDEYCGSPWNLNNMPKLKGSMLQAIRHNIN 
GVTVPWLYLGMLFSSFCWHFEDHCFYSVNYLHWGEAKCWYGIPGSAASAFEKVMRKTLPD 
LFDAQPDLLFQLVTMLSPTVLQENKVPVYTVLQEPGNFVITFPKSFHAGFNFGLNCAEAV 
NFATADWLPYGGSGAELYRLYRKPSVISHEELLCVVAKGNCCNNEGSIHLKKELLRIYSK 
EKTWREQLWKSGILRSSPMFVPECADSVGIEEDPTCIICQQFLHLSAIVCNCRPSVFACL 
EHWKHLCECEPTKLRLEYRYTLAELDMMVQEVEKFGGCKTQETKISQRPSSGTKRSIALN 
KKQEGMQVSQARPADKWLLRASKVLDAAFSSVEYATLLKESEQFLWAGSEMDRVRDVTKS 
LNKAKIWAEAVSDCLSKVEGEVNDDSMKVHLEFIDELLRVNPVPCFNSGYLKLKDYAEEA 
RKLSEKIDSALSSSPTITQLELLHSEVSRSPISLKKHEILSKKISSAKMLAKRAKRYLTD 
AKPPGIEMDALFKLNSEMLELHVQLPETEGILDLVKKSESARDKSNKVLTGSLSLENVEE 
LLHEFDSFSINVPELNILRQYHVDTLSWISRFNDVMVDVREGKDQRKLISDLSSLLRDGA 
SLGIQVEGLPLVEVELKKASCREKARTVYTARKSLDFIEQLLSEAVILHIEEEEIFVEIS 
GILSTARCWEERASTILENETQMYELKDLVRMSVNIDAVLPTLQGIENTISSAETWLQKS 
EPFLSATSSMASSPCSMLELPVLKDLVTQAKLLNVQLQEPRILETLLLNCERWQCDNHQL 
LQETEDLLDNAKIDDGTHSNILPKIMDLITRVDSARRSGLALGLNFDELPKLRTASLKLG 
WCCKTITLSSSSPTSELLEDVGKPSLQHIQQHLKEGQTLEILPEEYYLGKRLMELKDTGL 
EWAKRARKVVTDSGALALEDVFELISEGENLPVHAEQELQSLRARSMLHCICLKPYNSRS 
MVSCSQCGEWYHTYCLKLHWRPKAYVCSACCPLAETTPQIDPARATEPERPSLNQRRTRM 
VATDAAVNDLKWKTRKHIKRTTKRSPQVHILPWFFT*
>AT5G60410.2 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.2 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.2 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.2 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.2 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.1 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE*
>AT5G60410.1 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE*
>AT5G60410.1 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE*
>AT5G60410.1 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE*
>AT5G60410.1 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE*
>AT5G60410.3 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETGLFPV*
>AT5G60410.3 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETGLFPV*
>AT5G60410.3 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETGLFPV*
>AT5G60410.3 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETGLFPV*
>AT5G60410.3 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETGLFPV*
>AT5G60410.4 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN*
>AT5G60410.4 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN*
>AT5G60410.4 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN*
>AT5G60410.4 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN*
>AT5G60410.4 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN*
>AT5G60410.5 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.5 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.5 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.5 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*
>AT5G60410.5 |  SIZ1 DNA binding / SUMO ligase 
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV 
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS 
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP 
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW 
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV 
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN 
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF 
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR 
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM 
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV 
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN 
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET 
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG 
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD 
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSETMNRIIRQDTGV*

Your search returns no results, please check if everything was correct, and feel free to resubmit your search